HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A7I4

Names and origin
Entry : E7A7I4 (unreviewed)
Entry name : E7A7I4_HAEIF
Protein names : Na(+)-translocating NADH-quinone reductase subunit E (Na(+)-NQR subunit E) (Na(+)-translocating NQR subunit E) (EC 1.6.5.-) (NQR complex subunit E) (NQR-1 subunit E)
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : nqrE
ORF names : HIBPF_19920
EC number : 1.6.5.-
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : Gram-negative-bacterium-type cell wall; integral to membrane; oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor; plasma membrane; respiratory electron transport chain; sodium ion transport
GO identifier : GO:0009276; GO:0016021; GO:0016655; GO:0005886; GO:0022904; GO:0006814
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Ion transport; Membrane; NAD; Oxidoreductase; Sodium; Sodium transport; Transmembrane; Transmembrane helix; Transport; Ubiquinone
General annotation
Sequence similarities : Belongs to NqrDE/RnfAE family
Subcellular location : Cell inner membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Reference
PubMed ID : 22377449
Protein sequence
Length : 214 residues
>E7A7I4|E7A7I4_HAEIF Haemophilus influenzae F3031
MEHYISLFVKAVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVTFVLGIAVPVNQLIY
ANVLKENALIEGVDLSFLNFITFIGVIAGLVQILEMVLDKFMPSLYNALGIFLPLIAVNC
AIFGGVSFMVQRDYNFPESIVYGFGSGLGWMLAIVALAGLTEKMKYADIPAGLKGLGITF
ISVGLMALGFMSFSGIQL