HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A7B7

Names and origin
Entry : E7A7B7 (unreviewed)
Entry name : E7A7B7_HAEIF
Protein names : RNA-binding protein Hfq
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : hfq
ORF names : HIBPF_19240
History
Date of creation : 2011-03-08
Date of modification : 2013-12-11
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003723; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : RNA-binding; Stress response
General annotation
Sequence similarities : Belongs to Hfq family
Reference
PubMed ID : 22377449
Protein sequence
Length : 99 residues
>E7A7B7|E7A7B7_HAEIF Haemophilus influenzae F3031
MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS
TVVPARSVSHHNNNHHTAPTEAVENVETQAE