HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A7A0

Names and origin
Entry : E7A7A0 (unreviewed)
Entry name : E7A7A0_HAEIF
Protein names : Disulfide bond formation protein B (Disulfide oxidoreductase)
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : dsbB
ORF names : HIBPF_19040
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : electron carrier activity; integral to membrane; plasma membrane; protein disulfide oxidoreductase activity
GO identifier : GO:0009055; GO:0016021; GO:0005886; GO:0015035
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Chaperone; Disulfide bond; Electron transport; Membrane; Oxidoreductase; Redox-active center; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to DsbB family
Subcellular location : Cell inner membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Reference
PubMed ID : 22377449
Protein sequence
Length : 189 residues
>E7A7A0|E7A7A0_HAEIF Haemophilus influenzae F3031
MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGII
ALLQPRVFILRLIALALGLFSSIKGLLISFRHLDLQMNPAPWKQCEFIPNFPETLPFHQW
FPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIAQVIKTRKQRRLFN