HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A786

Names and origin
Entry : E7A786 (unreviewed)
Entry name : E7A786_HAEIF
Protein names : Nucleoid-associated protein HIBPF_18900
Organism : Haemophilus influenzae F3031
Organism ID : 866630
ORF names : HIBPF_18900
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; bacterial nucleoid; cytoplasm
GO identifier : GO:0003677; GO:0043590; GO:0005737
Keywords
Ligand & Biological process : Cytoplasm; DNA-binding
General annotation
Sequence similarities : Belongs to YbaB/EbfC family
Subcellular location : Cytoplasm › nucleoid.
Reference
PubMed ID : 22377449
Protein sequence
Length : 117 residues
>E7A786|E7A786_HAEIF Haemophilus influenzae F3031
MFGKGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKIIINGAHNCRRIDIDPS
LMEDDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF