HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A783

Names and origin
Entry : E7A783 (unreviewed)
Entry name : E7A783_HAEIF
Protein names : Protein-export membrane protein SecG
Organism : Haemophilus influenzae F3031
Organism ID : 866630
ORF names : HIBPF_18870
History
Date of creation : 2011-03-08
Date of modification : 2012-11-28
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : P-P-bond-hydrolysis-driven protein transmembrane transporter activity; integral to membrane; protein secretion
GO identifier : GO:0015450; GO:0016021; GO:0009306
Reference
PubMed ID : 22377449
Protein sequence
Length : 121 residues
>E7A783|E7A783_HAEIF Haemophilus influenzae F3031
MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA
TAFFVIALVLGNMNSHKGNVQKGAFDDLSQAAEQVQQQQAAPAKENKNSDIPQ