HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A747

Names and origin
Entry : E7A747 (unreviewed)
Entry name : E7A747_HAEIF
Protein names : ATP synthase subunit b (ATP synthase F(0) sector subunit b) (ATPase subunit I) (F-type ATPase subunit b)
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : atpF
ORF names : HIBPF_18470
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, coupling factor F(o)
GO identifier : GO:0016021; GO:0005886; GO:0042777; GO:0046933; GO:0045263
Keywords
Ligand & Biological process : ATP synthesis; CF(0); Cell membrane; Hydrogen ion transport; Ion transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to ATPase B chain family
Subcellular location : Cell membrane; Single-pass membrane protein.
Reference
PubMed ID : 22377449
Protein sequence
Length : 168 residues
>E7A747|E7A747_HAEIF Haemophilus influenzae F3031
MNLNATLIGQLIAFALFVWFCMKFVWPPIINAIETRQSQIANALASAEAAKKEQADTKNL
VEQELSAAKLQAQDILDAANKRRNEVLDEVKAEAEELKAKIIAQGYAEVEAERKRVQEEL
RLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL