HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A6Y9

Names and origin
Entry : E7A6Y9 (unreviewed)
Entry name : E7A6Y9_HAEIF
Protein names : 10 kDa chaperonin (GroES protein) (Protein Cpn10)
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : groS
ORF names : groES
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; cytoplasm; protein folding
GO identifier : GO:0005524; GO:0005737; GO:0006457
Keywords
Ligand & Biological process : Chaperone; Cytoplasm
General annotation
Sequence similarities : Belongs to GroES chaperonin family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 104 residues
>E7A6Y9|E7A6Y9_HAEIF Haemophilus influenzae F3031
MNIRPLHDRVIIKREEVETRSAGGIVLTGSAATKSTRAKVLAVGKGRILENGTVQPLDVK
VGDTVIFNDGYGVKSERIDGEEVLIISENDILAIVE