HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A6Y5

Names and origin
Entry : E7A6Y5 (unreviewed)
Entry name : E7A6Y5_HAEIF
Protein names : Primosomal replication protein n
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : priB
ORF names : HIBPF_17830
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA replication, synthesis of RNA primer; primosome complex; single-stranded DNA binding
GO identifier : GO:0006269; GO:1990077; GO:0003697
Keywords
Ligand & Biological process : DNA replication; DNA-binding; Primosome
General annotation
Domains : SSB domain (1)
Sequence similarities : Belongs to PriB family
Reference
PubMed ID : 22377449
Protein sequence
Length : 116 residues
>E7A6Y5|E7A6Y5_HAEIF Haemophilus influenzae F3031
MLKSNLKIDNRFSVMGVVSQLPKRLKSPSGIEHCKFLLEHRSDQIESGFTRQAWLKMPVQ
ISGNQLIEKTQSITVGSKILVVGFITSHKTQSGLCQLVLHAEQIEFID