HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A6Y3

Names and origin
Entry : E7A6Y3 (unreviewed)
Entry name : E7A6Y3_HAEIF
Protein names : Translation initiation factor IF-1
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : infA
ORF names : HIBPF_17810
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; translation initiation factor activity
GO identifier : GO:0005737; GO:0003743
Keywords
Ligand & Biological process : Cytoplasm; Initiation factor; Protein biosynthesis
General annotation
Domains : S1-like domain (1)
Sequence similarities : Belongs to IF-1 family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 80 residues
>E7A6Y3|E7A6Y3_HAEIF Haemophilus influenzae F3031
MAKEDCIEMQGTILETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPY
DLSKGRIIFRSR