HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A6V3

Names and origin
Entry : E7A6V3 (unreviewed)
Entry name : E7A6V3_HAEIF
Protein names : Uncharacterized protein
Organism : Haemophilus influenzae F3031
Organism ID : 866630
ORF names : HIBPF_17500
History
Date of creation : 2011-03-08
Date of modification : 2013-05-29
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cytoplasm; tRNA wobble position uridine thiolation
GO identifier : GO:0005737; GO:0002143
Reference
PubMed ID : 22377449
Protein sequence
Length : 103 residues
>E7A6V3|E7A6V3_HAEIF Haemophilus influenzae F3031
MLYTFSQSDYPKTELDDYFSYITEKDTVVLWQDGVLLAIKYPDYFAKCKGNCMILKQDIL
ARNITALLPQSSKIKLISIEELVGITENYLPQLSL