HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A6T3

Names and origin
Entry : E7A6T3 (unreviewed)
Entry name : E7A6T3_HAEIF
Protein names : Cell division protein ZapB
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : zapB
ORF names : HIBPF_17180
History
Date of creation : 2011-03-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytokinesis by binary fission; cytoplasm
GO identifier : GO:0000917; GO:0043093; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Coiled coil; Cytoplasm; Septation
General annotation
Sequence similarities : Belongs to ZapB family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 80 residues
>E7A6T3|E7A6T3_HAEIF Haemophilus influenzae F3031
MSLEILDQLEEKIKQAVETIQLLQLEVEELKEKNAESQRNIENLQTENEQLKNEHRNWQE
HIRSLLGKFDNV