HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A6J6

Names and origin
Entry : E7A6J6 (unreviewed)
Entry name : E7A6J6_HAEIF
Protein names : Putative fluoride ion transporter CrcB
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : crcB
ORF names : HIBPF_16130
History
Date of creation : 2011-03-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : inorganic anion transmembrane transporter activity; inorganic anion transport; integral to plasma membrane
GO identifier : GO:0015103; GO:0015698; GO:0005887
Keywords
Ligand & Biological process : Cell membrane; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to CrcB (TC 9.B.71) family
Subcellular location : Cell membrane; Multi-pass membrane protein.
Reference
PubMed ID : 22377449
Protein sequence
Length : 140 residues
>E7A6J6|E7A6J6_HAEIF Haemophilus influenzae F3031
MQALLFISCGAILGASLRWAIGLLFNPLFSSFAFGTLIANLLGCLIIGVLLGLFWQFPQI
SSEWRLFLITGFLGSLTTFSSFSSEVVELFFNDKWLNGFCVLMMHLFGCLAMTVLGIWIY
KICSQLLS