HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A6I1

Names and origin
Entry : E7A6I1 (unreviewed)
Entry name : E7A6I1_HAEIF
Protein names : L-fucose mutarotase (EC 5.1.3.n2) (Fucose 1-epimerase) (Type-2 mutarotase)
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : fucU
ORF names : HIBPF_15980
EC number : 5.1.3.n2
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : L-fucose metabolic process; cytoplasm; fucose binding; racemase and epimerase activity, acting on carbohydrates and derivatives
GO identifier : GO:0042354; GO:0005737; GO:0042806; GO:0016857
Keywords
Ligand & Biological process : Carbohydrate metabolism; Cytoplasm; Fucose metabolism; Isomerase
General annotation
Pathway : Carbohydrate metabolism; L-fucose metabolism.
Sequence similarities : Belongs to RbsD / FucU family, FucU mutarotase subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 156 residues
>E7A6I1|E7A6I1_HAEIF Haemophilus influenzae F3031
MLKGIHPALSPELLKTLAEMGHGDEIVLADAHFPAHSLHKNVIRADGISIDILLEAITPL
FEFDAYVDAPLFMMKAVEGDSLDPNVETRYLNAIESAVGFTPNLTCLERFDFYTRAKQAY
AVVVSGEIAKYGNIIIKKGVTPIL