HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A6G3

Names and origin
Entry : E7A6G3 (unreviewed)
Entry name : E7A6G3_HAEIF
Protein names : Protein CyaY
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : cyaY
ORF names : HIBPF_15800
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ferric iron binding; iron-sulfur cluster assembly
GO identifier : GO:0008199; GO:0016226
General annotation
Sequence similarities : Belongs to Frataxin family
Reference
PubMed ID : 22377449
Protein sequence
Length : 109 residues
>E7A6G3|E7A6G3_HAEIF Haemophilus influenzae F3031
MNIAEFHQNIEQVWQKIEEELENQGADVDCETQGSVFTITFDNRTQIVINKQEPLLELWI
ASKLGGFHFAFKNGDWVSNDGQRFWDCFVEACAAHGENVQF