HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A6D7

Names and origin
Entry : E7A6D7 (unreviewed)
Entry name : E7A6D7_HAEIF
Protein names : 50S ribosomal protein L31
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : rpmE
ORF names : HIBPF_15530
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : metal ion binding; rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0046872; GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Metal-binding; RNA-binding; Ribonucleoprotein; Ribosomal protein; Zinc; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L31P family, Type A subfamily
Reference
PubMed ID : 22377449
Protein sequence
Length : 78 residues
>E7A6D7|E7A6D7_HAEIF Haemophilus influenzae F3031
MKQGIHPEYKEITATCSCGNVIKTRSTLGKDINLDVCGNCHPFYTGKQRVVDTGGRVERF
NSRFKIPSTK