HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A6B5

Names and origin
Entry : E7A6B5 (unreviewed)
Entry name : E7A6B5_HAEIF
Protein names : 50S ribosomal protein L29
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : rpmC
ORF names : HIBPF_15300
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L29P family
Reference
PubMed ID : 22377449
Protein sequence
Length : 71 residues
>E7A6B5|E7A6B5_HAEIF Haemophilus influenzae F3031
MKAQDLRTKSVEELNAELVNLLGEQFKLRMQTATGQLQQTHQAKQVRRDIARVKTVLTEK
AGE