HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A686

Names and origin
Entry : E7A686 (unreviewed)
Entry name : E7A686_HAEIF
Protein names : Carbon storage regulator homolog
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : csrA
ORF names : HIBPF_14950
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; mRNA catabolic process; regulation of carbohydrate metabolic process
GO identifier : GO:0003723; GO:0006402; GO:0006109
Keywords
Ligand & Biological process : RNA-binding
General annotation
Sequence similarities : Belongs to CsrA family
Reference
PubMed ID : 22377449
Protein sequence
Length : 71 residues
>E7A686|E7A686_HAEIF Haemophilus influenzae F3031
MLILTRKVGESVLIGDDISITVLSVRGNQVKLGVEAPKEVSVHREEIYQRIKQTKDEPYL
GSS