HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A669

Names and origin
Entry : E7A669 (unreviewed)
Entry name : E7A669_HAEIF
Protein names : Trp operon repressor homolog
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : trpR
ORF names : HIBPF_14780
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; negative regulation of transcription, DNA-dependent; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0005737; GO:0045892; GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Cytoplasm; DNA-binding; Repressor; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to TrpR family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 109 residues
>E7A669|E7A669_HAEIF Haemophilus influenzae F3031
MYISRNLEQWNAFLQMLKIAFEENKAQEFLTLLLTADERDAVGLRLQIVSQLLDKNLPQR
EIQQNLNTSAATITRGSNMIKTMDPDFMQWMKQHLDLIEKN