HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A667

Names and origin
Entry : E7A667 (unreviewed)
Entry name : E7A667_HAEIF
Protein names : Fumarate reductase subunit D
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : frdD
ORF names : HIBPF_14760
History
Date of creation : 2011-03-08
Date of modification : 2012-11-28
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : fumarate metabolic process; integral to membrane; plasma membrane
GO identifier : GO:0006106; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FrdD family
Subcellular location : Cell inner membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Reference
PubMed ID : 22377449
Protein sequence
Length : 122 residues
>E7A667|E7A667_HAEIF Haemophilus influenzae F3031
MVDQNPKRSGEPPVWLMFGAGGTVSAIFLPVVILIIGLLLPFGLVDAHNLITFAYSWIGK
LVILVLTIFPMWCGLHRIHHGMHDLKIHVPAGGFIFYGLATIYTVWVLFAVINL