HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A662

Names and origin
Entry : E7A662 (unreviewed)
Entry name : E7A662_HAEIF
Protein names : Uncharacterized protein
Organism : Haemophilus influenzae F3031
Organism ID : 866630
ORF names : HIBPF_14710
History
Date of creation : 2011-03-08
Date of modification : 2012-11-28
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Reference
PubMed ID : 22377449
Protein sequence
Length : 51 residues
>E7A662|E7A662_HAEIF Haemophilus influenzae F3031
MMSLVITVPNFDLRIYSPLKEANIVNYQKEILGGLSMNIKLPLWITH