HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A5R3

Names and origin
Entry : E7A5R3 (unreviewed)
Entry name : E7A5R3_HAEIF
Protein names : 30S ribosomal protein S20
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : rpsT
ORF names : HIBPF_12820
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein S20P family
Reference
PubMed ID : 22377449
Protein sequence
Length : 95 residues
>E7A5R3|E7A5R3_HAEIF Haemophilus influenzae F3031
MANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVVAGEKSAAEAAFVEMQKVVDR
MASKGLIHANKAANHKSKLAAQIKKLA