HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A4N9

Names and origin
Entry : E7A4N9 (unreviewed)
Entry name : E7A4N9_HAEIF
Protein names : Glutaredoxin
Organism : Haemophilus influenzae F3031
Organism ID : 866630
ORF names : HIBPF_08790
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0009055; GO:0015035
Reference
PubMed ID : 22377449
Protein sequence
Length : 95 residues
>E7A4N9|E7A4N9_HAEIF Haemophilus influenzae F3031
MFVTIFGRPGCPYCVRAKNLAEKLKGKVADFDYRYVDIHAEGITKEDLSKSVGKPVETVP
QIFIDEKPIGGCTDFEALMKEQFGIVA