HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A4K5

Names and origin
Entry : E7A4K5 (unreviewed)
Entry name : E7A4K5_HAEIF
Protein names : Predicted 2Fe-2S cluster-containing protein
Organism : Haemophilus influenzae F3031
Organism ID : 866630
ORF names : HIBPF_08420
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; electron carrier activity; metal ion binding
GO identifier : GO:0051537; GO:0009055; GO:0046872
Keywords
Ligand & Biological process : 2Fe-2S; Iron; Iron-sulfur; Metal-binding
General annotation
Domains : 2Fe-2S ferredoxin-type domain (1)
Reference
PubMed ID : 22377449
Protein sequence
Length : 90 residues
>E7A4K5|E7A4K5_HAEIF Haemophilus influenzae F3031
MKIHLIRHNTTLEFNNETSLLDHLEKNNIHHEYQCRSGYCGSCRVKIKKGKVSYKEMPLA
FIQPDEILLCCCHVESDLEIDL