HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A4I6

Names and origin
Entry : E7A4I6 (unreviewed)
Entry name : E7A4I6_HAEIF
Protein names : Transcription elongation factor GreA (Transcript cleavage factor GreA)
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : greA
ORF names : HIBPF_08200
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; regulation of DNA-dependent transcription, elongation; transcription, DNA-dependent; translation elongation factor activity
GO identifier : GO:0003677; GO:0032784; GO:0006351; GO:0003746
Keywords
Ligand & Biological process : DNA-binding; Elongation factor; Protein biosynthesis; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to GreA/GreB family
Reference
PubMed ID : 22377449
Protein sequence
Length : 170 residues
>E7A4I6|E7A4I6_HAEIF Haemophilus influenzae F3031
MQQIPMTVRGAEQLRQELDFLKNVRRPEIIKAIAEAREHGDLKENAEYHAAREQQGFCEG
RIQEIEGKLGNAQVIDVTKMPNNGKVIFGTTVVLVNTDTDEEVTYRIVGDDEADIKSGLI
SVNSPIARGLIGKELDDTVNITTPGGVVEFDIIEVNYI