HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A4F3

Names and origin
Entry : E7A4F3 (unreviewed)
Entry name : E7A4F3_HAEIF
Protein names : UPF0181 protein HIBPF_07820
Organism : Haemophilus influenzae F3031
Organism ID : 866630
ORF names : HIBPF_07820
History
Date of creation : 2011-03-08
Date of modification : 2012-11-28
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
General annotation
Sequence similarities : Belongs to UPF0181 family
Reference
PubMed ID : 22377449
Protein sequence
Length : 56 residues
>E7A4F3|E7A4F3_HAEIF Haemophilus influenzae F3031
MFDINLTHEQQQKAVEQIQELMAKGISSGEAIQIVAKALREIHKNDKKTPEN