HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A4F2

Names and origin
Entry : E7A4F2 (unreviewed)
Entry name : E7A4F2_HAEIF
Protein names : Cold shock protein homolog
Organism : Haemophilus influenzae F3031
Organism ID : 866630
ORF names : HIBPF_07810
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003677; GO:0005737; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Cytoplasm
General annotation
Domains : CSD (cold-shock) domain (1)
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 80 residues
>E7A4F2|E7A4F2_HAEIF Haemophilus influenzae F3031
MEIGIVKWFNNAKGFGFISAEGVDADIFAHYSVIEMDGYRSLKAGQKVQFEVLHGDKGSH
ATKIIPIADTQE