HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A401

Names and origin
Entry : E7A401 (unreviewed)
Entry name : E7A401_HAEIF
Protein names : Integration host factor subunit beta (IHF-beta)
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : ihfB
ORF names : himD
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; DNA recombination; chromosome; regulation of transcription, DNA-dependent; regulation of translation; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0006310; GO:0005694; GO:0006355; GO:0006417; GO:0006351
Keywords
Ligand & Biological process : DNA recombination; DNA-binding; Transcription; Transcription regulation; Translation regulation
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Reference
PubMed ID : 22377449
Protein sequence
Length : 102 residues
>E7A401|E7A401_HAEIF Haemophilus influenzae F3031
MTKSELMEKLSAKQPTLPAKEIENMVKDILEFISQSLEKGDRVEVRGFGSFSLHHRQPRL
GRNPKTGDSVNLSAKSVPYFKAGKELKARVDVQA