HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A3M8

Names and origin
Entry : E7A3M8 (unreviewed)
Entry name : E7A3M8_HAEIF
Protein names : Iron-sulfur cluster insertion protein ErpA
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : erpA
ORF names : HIBPF_04670
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : iron ion binding; iron-sulfur cluster assembly; iron-sulfur cluster binding; structural molecule activity
GO identifier : GO:0005506; GO:0016226; GO:0051536; GO:0005198
Keywords
Ligand & Biological process : Iron; Iron-sulfur; Metal-binding
General annotation
Sequence similarities : Belongs to HesB/IscA family
Reference
PubMed ID : 22377449
Protein sequence
Length : 122 residues
>E7A3M8|E7A3M8_HAEIF Haemophilus influenzae F3031
MIDDMAVPLTFTDAAANKVKSLISEEENTNLKLRVYITGGGCSGFQYGFTFDEKVNDGDL
TIEKSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI