HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QZ36

Names and origin
Entry : E4QZ36 (unreviewed)
Entry name : E4QZ36_HAEI6
Protein names : Ribosome-binding factor A
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : rbfA
ORF names : R2866_0871
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; rRNA processing
GO identifier : GO:0005737; GO:0006364
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; rRNA processing
General annotation
Sequence similarities : Belongs to RbfA family
Subcellular location : Cytoplasm.
Protein sequence
Length : 140 residues
>E4QZ36|E4QZ36_HAEI6 Haemophilus influenzae R2866
MAREFKRSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHD
ETAIEQGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDQSLVEGMRMSNLVTNVVREDE
KKHVEESN