HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QZ30

Names and origin
Entry : E4QZ30 (unreviewed)
Entry name : E4QZ30_HAEI6
Protein names : Ribosome maturation factor RimP
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : rimP
ORF names : R2866_0864
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; ribosome biogenesis
GO identifier : GO:0005737; GO:0042254
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Ribosome biogenesis
General annotation
Sequence similarities : Belongs to RimP family
Subcellular location : Cytoplasm.
Protein sequence
Length : 163 residues
>E4QZ30|E4QZ30_HAEI6 Haemophilus influenzae R2866
MATLEQNLQEMLQDAVEDLGCELWGIECQRVGRFMTVRLFIDKEGGVTVDNCADVSRQVS
AILDVEDPIADKYNLEVSSPGLDRPLFTLPQFERYIGQDIAVHLRIPVMERRKWQGKLER
IEKDMITLIVDDQEQILVFGNIQKANVVAKF