HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QZ08

Names and origin
Entry : E4QZ08 (unreviewed)
Entry name : E4QZ08_HAEI6
Protein names : Probable toxin-antitoxin locus protein (HigA-family)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : higA
ORF names : R2866_0840
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : sequence-specific DNA binding
GO identifier : GO:0043565
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 115 residues
>E4QZ08|E4QZ08_HAEI6 Haemophilus influenzae R2866
MMTRKPTSVGEILQEEFLEPLSLKISDLAQILDVHRNTASNIVNNSSRITLEMAVKLAKV
FDTTPEFWLNLQTRIDLWDLEHNKRFQQSLANVKPALHRHDTSTFAM