HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYY3

Names and origin
Entry : E4QYY3 (unreviewed)
Entry name : E4QYY3_HAEI6
Protein names : Translation initiation factor Sui1
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yciH
ORF names : R2866_0814
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : translation initiation factor activity
GO identifier : GO:0003743
Keywords
Ligand & Biological process : Complete proteome; Initiation factor; Protein biosynthesis
Protein sequence
Length : 114 residues
>E4QYY3|E4QYY3_HAEI6 Haemophilus influenzae R2866
MSDSVLVYSTDVGRIKEEKASVARPKGDGVVRIQKQTSGRKGAGVSVITGLDLSDEELKK
LAAELKKRCGCGGAVKNGIIEIQGEKRDLLKQLLEQKGFKVKLSGG