HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E4QYW7

Names and origin

Entry	:	E4QYW7 (unreviewed)
Entry name	:	E4QYW7_HAEI6
Protein names	:	UPF0102 protein R2866_0798
Organism	:	Haemophilus influenzae R2866
Organism ID	:	262728
Gene names	:	yraN
ORF names	:	R2866_0798

History

Date of creation	:	2011-02-08
Date of modification	:	2013-11-13
Date of sequence modification	:	2011-02-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	nuclease activity; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis
GO identifier	:	GO:0004518; GO:0003676; GO:0090305

Keywords

Ligand & Biological process

Complete proteome

General annotation

Sequence similarities

Belongs to UPF0102 family

Protein sequence

Length

127 residues

>E4QYW7|E4QYW7_HAEI6 Haemophilus influenzae R2866
MFSLKRQQGASFEHQARLFLESKGLTFIAANQNFKCGELDLIMNDKETIVFVEVRQRSHS
AYGSAIESVDWRKQQKWLDAANLWLAKQNMSLEDANCRFDLIAFGKTPQDIQWIPNFLD