HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYV1

Names and origin
Entry : E4QYV1 (unreviewed)
Entry name : E4QYV1_HAEI6
Protein names : Molybdopterin synthase, small subunit
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : moaD
ORF names : R2866_0782
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : Mo-molybdopterin cofactor biosynthetic process
GO identifier : GO:0006777
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 89 residues
>E4QYV1|E4QYV1_HAEI6 Haemophilus influenzae R2866
MLNVLFFAQTRELIGIDAIQLEDDFATAEAVREHLAQKGDKWALALEKGKLLVAINQTLM
PLESAVKNGDEIAFFPPVTGG