HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYV0

Names and origin
Entry : E4QYV0 (unreviewed)
Entry name : E4QYV0_HAEI6
Protein names : Cyclic pyranopterin monophosphate synthase accessory protein (Molybdenum cofactor biosynthesis protein C)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : moaC
ORF names : R2866_0781
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : Mo-molybdopterin cofactor biosynthetic process
GO identifier : GO:0006777
Keywords
Ligand & Biological process : Complete proteome; Molybdenum cofactor biosynthesis
General annotation
Pathway : Cofactor biosynthesis; molybdopterin biosynthesis.
Sequence similarities : Belongs to MoaC family
Protein sequence
Length : 172 residues
>E4QYV0|E4QYV0_HAEI6 Haemophilus influenzae R2866
MTTFTHINSQGEANMVDVSAKAETVREARAEAIVTMSKETLSMIVEGKHHKGDVFATARI
AGIQAAKRTWELIPLCHPLLLSKVEVNLEPLLETNQVRIQSLCKLTGKTGVEMEALTAAS
VAALTIYDMCKAVQKDIVIEKVRLLEKSGGKSGHFIAEEK