HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYU2

Names and origin
Entry : E4QYU2 (unreviewed)
Entry name : E4QYU2_HAEI6
Protein names : Electron transport complex protein RnfA
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : rnfA
ORF names : R2866_0772
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : electron transport chain; integral to membrane; plasma membrane
GO identifier : GO:0022900; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Electron transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to NqrDE/RnfAE family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 208 residues
>E4QYU2|E4QYU2_HAEI6 Haemophilus influenzae R2866
MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVD
HYILIPLNATFLRTLVFILVIAVVVQFTEMAINKTSPTLYRLLGIFLPLITTNCAVLGVA
LLNVNLAHNLTESVVYGFGASLGFSLVLVLFAALRERLIAADIPATFRGSSITLITAGLM
SLAFMGFTGLVK