HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYT3

Names and origin
Entry : E4QYT3 (unreviewed)
Entry name : E4QYT3_HAEI6
Protein names : Molybdenum ABC transporter, permease protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : modB
ORF names : R2866_0763
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; molybdate ion transmembrane transporter activity; plasma membrane
GO identifier : GO:0016021; GO:0015098; GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to Binding-protein-dependent transport system permease family
Subcellular location : Membrane; Multi-pass membrane protein.
Protein sequence
Length : 245 residues
>E4QYT3|E4QYT3_HAEI6 Haemophilus influenzae R2866
MEISAINLSLSVAVSSMLWSLPLAIFVAWLLARKNFYGKSLITGVIHLPLVLPPVVIGYL
LLVAMGRNGFIGKYLYQWFGLSFGFSWKGAVLSSAVVAFPLVVRAIRLSLENIDIKLEQA
AQTLGASAWRVFFTITLPLSLPGVLAGLVLGFARSLGEFGATITFVSNIAGETQTIPLAM
YSFIQTPGAEEQTARLCLFAIILSLISLLLSEWLSKRMQKKLGQGNVAD