HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYR2

Names and origin
Entry : E4QYR2 (unreviewed)
Entry name : E4QYR2_HAEI6
Protein names : PTS system, phosphocarrier protein HPr
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : ptsH
ORF names : R2866_0742
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; phosphoenolpyruvate-dependent sugar phosphotransferase system; protein serine/threonine kinase activity; sugar:hydrogen symporter activity
GO identifier : GO:0005737; GO:0009401; GO:0004674; GO:0005351
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Kinase; Phosphotransferase system; Serine/threonine-protein kinase; Transferase
General annotation
Subcellular location : Cytoplasm.
Protein sequence
Length : 93 residues
>E4QYR2|E4QYR2_HAEI6 Haemophilus influenzae R2866
MYSKDVEIIASNGLHTRPAAQFVKEAKAFSSEITVTSGGKSASAKSLFKLQTLALTQGTI
LTISADGEDEQQAVEHLVALIPTLE