HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E4QYQ6

Names and origin

Entry	:	E4QYQ6 (unreviewed)
Entry name	:	E4QYQ6_HAEI6
Protein names	:	Iron-sulfur cluster insertion protein ErpA
Organism	:	Haemophilus influenzae R2866
Organism ID	:	262728
Gene names	:	erpA
ORF names	:	R2866_0734

History

Date of creation	:	2011-02-08
Date of modification	:	2013-11-13
Date of sequence modification	:	2011-02-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	iron ion binding; iron-sulfur cluster assembly; iron-sulfur cluster binding; structural molecule activity
GO identifier	:	GO:0005506; GO:0016226; GO:0051536; GO:0005198

Keywords

Ligand & Biological process

Complete proteome; Iron; Iron-sulfur; Metal-binding

General annotation

Sequence similarities

Belongs to HesB/IscA family

Protein sequence

Length

122 residues

>E4QYQ6|E4QYQ6_HAEI6 Haemophilus influenzae R2866
MIDDMAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFDEKVNDGDL
TIEKSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI