HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYN3

Names and origin
Entry : E4QYN3 (unreviewed)
Entry name : E4QYN3_HAEI6
Protein names : DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : rpoZ
ORF names : R2866_0706
EC number : 2.7.7.6
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; DNA-directed RNA polymerase activity; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0003899; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA-directed RNA polymerase; Nucleotidyltransferase; Transcription; Transferase
General annotation
Sequence similarities : Belongs to RNA polymerase subunit omega family
Protein sequence
Length : 96 residues
>E4QYN3|E4QYN3_HAEI6 Haemophilus influenzae R2866
MARVTVQDAVEKIGNRFDLILTAARRARQLQLNQSVPLVPEDNDKPTVIALREIEKGLIN
QDIMDAQEFQKMAKVQETEEAAVALITE