HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYK8

Names and origin
Entry : E4QYK8 (unreviewed)
Entry name : E4QYK8_HAEI6
Protein names : Citrate lyase acyl carrier protein (Citrate lyase gamma chain)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : citD
ORF names : R2866_0681
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; lyase activity
GO identifier : GO:0005737; GO:0016829
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Lyase; Phosphoprotein
General annotation
Sequence similarities : Belongs to CitD family
Subcellular location : Cytoplasm.
Protein sequence
Length : 103 residues
>E4QYK8|E4QYK8_HAEI6 Haemophilus influenzae R2866
MKITKVAVAGTLESSDVQVRVQPFDSLDIEINSSVAKQFGEQIEATVREVLAKLGITAAQ
VIVEDKGALDCVLQARVKAAAMRATDEAINWEAVL