HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYK4

Names and origin
Entry : E4QYK4 (unreviewed)
Entry name : E4QYK4_HAEI6
Protein names : UPF0250 protein R2866_0677
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : ybeD
ORF names : R2866_0677
History
Date of creation : 2011-02-08
Date of modification : 2013-12-11
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0250 family
Protein sequence
Length : 100 residues
>E4QYK4|E4QYK4_HAEI6 Haemophilus influenzae R2866
MTIENDYAKLKELMEFPAKMTFKVAGINREGLAQDLIQVVQKYIKGDYIPKEKRSSKGTY
NSVSIDIIAENFDQVETLYKELAKVEGVKMVI