HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYJ8

Names and origin
Entry : E4QYJ8 (unreviewed)
Entry name : E4QYJ8_HAEI6
Protein names : Ribosomal silencing factor RsfS
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : ybeB
ORF names : rsfS
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; mature ribosome assembly; negative regulation of ribosome biogenesis; negative regulation of translation
GO identifier : GO:0005737; GO:0042256; GO:0090071; GO:0017148
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Repressor; Translation regulation
General annotation
Sequence similarities : Belongs to Iojap/RsfS family
Subcellular location : Cytoplasm.
Protein sequence
Length : 110 residues
>E4QYJ8|E4QYJ8_HAEI6 Haemophilus influenzae R2866
MALVEFLMETLDGLKGTDIVHFDVRGKSSITDNMIICTGMSSRQVSAMADNLITECKKAG
FETFGEEGKNTADWIVVDLGQAIVHIMQPDAREMYQLEKLWA