HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYE8

Names and origin
Entry : E4QYE8 (unreviewed)
Entry name : E4QYE8_HAEI6
Protein names : Regulatory protein RecX
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : recX
ORF names : R2866_1874
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; regulation of DNA repair
GO identifier : GO:0005737; GO:0006282
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm
General annotation
Sequence similarities : Belongs to RecX family
Subcellular location : Cytoplasm.
Protein sequence
Length : 164 residues
>E4QYE8|E4QYE8_HAEI6 Haemophilus influenzae R2866
MSSLAFNYIVNLLSRREYSEFELRNKMQEKNFSEEEIDEALSRCQAKNWQSDRRFSENYL
NSRAQKGYGVGRIRQELRQLKGVSSDIIDEVLMESEIDWYEMAENLLRKKFPNYNEQQTP
KMKQKIWQYMLSHGFRSDEFADLIGQNQSEWD