HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYD9

Names and origin
Entry : E4QYD9 (unreviewed)
Entry name : E4QYD9_HAEI6
Protein names : Large-conductance mechanosensitive channel
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : mscL
ORF names : R2866_1861
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; ion channel activity; plasma membrane
GO identifier : GO:0016021; GO:0005216; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Ion channel; Ion transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to MscL family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 140 residues
>E4QYD9|E4QYD9_HAEI6 Haemophilus influenzae R2866
MNFIKEFREFAMRGNVVDMAIGVIIGSAFGKIVSSLVSDIFTPVLGILTGGIDFKDMKFV
LAQAQGDVPAVTLNYGLFIQNVIDFIIIAFAIFMMIKVINKVRKPEEKKTAPKAETLLTE
IRDLLKNK