HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QYC0

Names and origin
Entry : E4QYC0 (unreviewed)
Entry name : E4QYC0_HAEI6
Protein names : Putative nucleotidyltransferase protein component
Organism : Haemophilus influenzae R2866
Organism ID : 262728
ORF names : R2866_0631
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : nucleotidyltransferase activity
GO identifier : GO:0016779
Keywords
Ligand & Biological process : Complete proteome; Transferase
Protein sequence
Length : 122 residues
>E4QYC0|E4QYC0_HAEI6 Haemophilus influenzae R2866
MTSFAQLDINSEELAIVKTILQQLVPDYTVWAFGSRVKGKAKKYSDLDLAIISEEPLDFL
ARDRLKEAFSESDLPWRVDLLDWATTSEDFREIIRKVYVVIQEKEKTVEKPTAL