HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QY58

Names and origin
Entry : E4QY58 (unreviewed)
Entry name : E4QY58_HAEI6
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
ORF names : R2866_0566
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 56 residues
>E4QY58|E4QY58_HAEI6 Haemophilus influenzae R2866
MNITLNWNGFLFAIVFVLFFMGTVAFIGVRSLKRQQEQKAQSKKTHSLGVNS