HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QY15

Names and origin
Entry : E4QY15 (unreviewed)
Entry name : E4QY15_HAEI6
Protein names : Cell division protein ZapB
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : zapB
ORF names : R2866_1806
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytokinesis by binary fission; cytoplasm
GO identifier : GO:0000917; GO:0043093; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Coiled coil; Complete proteome; Cytoplasm; Septation
General annotation
Sequence similarities : Belongs to ZapB family
Subcellular location : Cytoplasm.
Protein sequence
Length : 80 residues
>E4QY15|E4QY15_HAEI6 Haemophilus influenzae R2866
MSLEILDQLEEKIKQAVETIQLLQLEVEELKEKNAESQRNIENLQTENEQLKNEHRNWQE
HIRSLLGKFDNV