HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QY10

Names and origin
Entry : E4QY10 (unreviewed)
Entry name : E4QY10_HAEI6
Protein names : Cell division protein FtsB
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : ftsB
ORF names : R2866_1801
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell division site; cytokinesis by binary fission; integral to plasma membrane
GO identifier : GO:0032153; GO:0043093; GO:0005887
Keywords
Ligand & Biological process : Cell cycle; Cell division; Cell inner membrane; Cell membrane; Coiled coil; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FtsB family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein.
Protein sequence
Length : 100 residues
>E4QY10|E4QY10_HAEI6 Haemophilus influenzae R2866
MRLLILILLSVLVLFQYNFWFGSNGFLDYRQNAEKIKENQAENEKLSQRNQRINAEIQGL
TKGFEAIEERARMQHGLVKENEVFYHIVKESK