HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QY09

Names and origin
Entry : E4QY09 (unreviewed)
Entry name : E4QY09_HAEI6
Protein names : Xanthine phosphoribosyltransferase (EC 2.4.2.22) (Xanthine-guanine phosphoribosyltransferase)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : gptA
ORF names : gpt
EC number : 2.4.2.22
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : XMP salvage; magnesium ion binding; plasma membrane; purine ribonucleoside salvage; xanthine phosphoribosyltransferase activity
GO identifier : GO:0032265; GO:0000287; GO:0005886; GO:0006166; GO:0000310
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Glycosyltransferase; Magnesium; Membrane; Metal-binding; Purine salvage; Transferase
General annotation
Pathway : Purine metabolism; XMP biosynthesis via salvage pathway; XMP from xanthine: step 1/1.
Sequence similarities : Belongs to Purine/pyrimidine phosphoribosyltransferase family, XGPT subfamily
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Protein sequence
Length : 167 residues
>E4QY09|E4QY09_HAEI6 Haemophilus influenzae R2866
MSEKYVVTWDMFQMHARKLSERLLPASQWKGIIAVSRGGLFPAAVLARELGLRHIETVCI
ASYHDHNNQGELQVLHAAQVPNGGEGFIVVDDLVDTGNTARAIRQMYPNAKFVTVFAKPA
GAELVDDYVIDIPQNTWIEQPWDLGLTFVPPLSRK